Skip to main content

Protein Molecular Weight Calculator

Calculate protein molecular weight with our free science calculator. Uses standard scientific formulas with unit conversions and explanations.

Skip to calculator
Biology

Protein Molecular Weight Calculator

Calculate protein molecular weight from amino acid sequence or residue count. Get extinction coefficient, estimated pI, amino acid composition, and more.

Last updated: December 2025

Calculator

Adjust values & calculate
Valid residues: A C D E F G H I K L M N P Q R S T V W Y. Other characters are ignored.
Molecular Weight
5.63 kDa
5,626.41 Da | 51 residues
Residue Count
51
Avg Residue Weight
109.97 Da
E280 (Extinction)
8,480
M-1 cm-1
Est. pI
8.7
Hydrophobic
47.1%

Amino Acid Composition

A
7 (13.7%)
L
4 (7.8%)
K
4 (7.8%)
T
4 (7.8%)
G
4 (7.8%)
F
4 (7.8%)
V
3 (5.9%)
S
3 (5.9%)
P
3 (5.9%)
H
3 (5.9%)
E
3 (5.9%)
M
2 (3.9%)
D
2 (3.9%)
Y
2 (3.9%)
N
1 (2.0%)
W
1 (2.0%)
R
1 (2.0%)
Note: This calculates the theoretical molecular weight from the primary sequence only. Post-translational modifications (glycosylation, phosphorylation, etc.) will increase the actual molecular weight. For native protein MW, use mass spectrometry.
Your Result
MW: 5,626.41 Da (5.63 kDa) | 51 residues | Avg: 109.97 Da/residue
Share Your Result
Understand the Math

Formula

MW = Sum of all residue weights + 18.015 Da (water)

Each amino acid residue contributes its specific molecular weight (ranging from 57 Da for glycine to 186 Da for tryptophan). One water molecule (18.015 Da) is added to account for the free N-terminal amino group and C-terminal carboxyl group. For estimates, use 110 Da per residue average. The extinction coefficient uses the Pace method: E280 = nTrp x 5500 + nTyr x 1490 + nCys x 125.

Last reviewed: December 2025

Worked Examples

Example 1: Human Insulin B-Chain

Calculate the molecular weight of the insulin B-chain with sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (30 residues).
Solution:
Sum individual residue weights: F(147.18) + V(99.13) + N(114.10) + Q(128.13) + H(137.14) + L(113.16) + C(103.14) + G(57.05) + S(87.08) + H(137.14) + L(113.16) + V(99.13) + E(129.12) + A(71.08) + L(113.16) + Y(163.18) + L(113.16) + V(99.13) + C(103.14) + G(57.05) + E(129.12) + R(156.19) + G(57.05) + F(147.18) + F(147.18) + Y(163.18) + T(101.11) + P(97.12) + K(128.17) + T(101.11) Sum + H2O (18.02) = 3,400.9 Da
Result: MW: ~3,401 Da (3.4 kDa) | E280: 4,470 M-1cm-1 | 30 residues

Example 2: Estimating MW from Residue Count

A protein has 450 amino acid residues. Estimate its molecular weight.
Solution:
Using average residue weight of 110 Da: MW = 450 x 110 + 18 (water) = 49,518 Da Round: ~49.5 kDa This is typical of a medium-sized enzyme.
Result: Estimated MW: ~49.5 kDa | Typical range for 450 residues: 47-52 kDa
Expert Insights

Background & Theory

The Protein Molecular Weight Calculator applies the following established principles and formulas. Chemistry is the science of matter's composition, structure, properties, and transformations. At the heart of quantitative chemistry lies the mole concept. One mole of any substance contains exactly 6.022ร—10ยฒยณ entities (Avogadro's number, Nโ‚), and the molar mass of an element or compound in grams per mole is numerically equal to its atomic or molecular mass in atomic mass units. This allows chemists to convert between measurable mass and the number of reacting particles. Stoichiometry uses balanced chemical equations to relate the amounts of reactants and products. A balanced equation conserves both mass and charge. Molarity, the most common concentration unit, is defined as M = n/V, where n is moles of solute and V is volume of solution in liters, giving units of mol/L. Acidity and basicity are quantified by the pH scale, defined as pH = โˆ’logโ‚โ‚€[Hโบ], where [Hโบ] is the molar concentration of hydrogen ions. Pure water at 25ยฐC has pH 7.00; acids have lower values and bases higher values. Each unit change represents a tenfold change in hydrogen ion concentration. Gas behavior is described by the ideal gas law PV = nRT, where P is pressure in pascals, V is volume in cubic meters, n is moles, R = 8.314 J/(molยทK), and T is temperature in kelvin. Special cases include Boyle's Law (Pโ‚Vโ‚ = Pโ‚‚Vโ‚‚ at constant temperature) and Charles's Law (Vโ‚/Tโ‚ = Vโ‚‚/Tโ‚‚ at constant pressure). Thermochemistry quantifies heat changes in reactions through enthalpy, H. Hess's Law states that the total enthalpy change for a reaction is the sum of enthalpy changes for any sequence of steps leading to the same overall reaction, making it possible to calculate enthalpies for reactions that cannot be measured directly. Electron configuration describes the distribution of electrons in atomic orbitals according to the Aufbau principle, Pauli exclusion principle, and Hund's rule. Periodic trends including atomic radius, ionization energy, and electronegativity arise systematically from electron configuration and nuclear charge, enabling chemists to predict and rationalize chemical behavior across the periodic table.

History

The history behind the Protein Molecular Weight Calculator traces back through the following developments. Chemistry's roots lie in alchemy, the medieval practice combining proto-scientific experimentation with mystical aims. Alchemists developed practical techniques including distillation, calcination, and the preparation of acids, building a body of empirical knowledge despite their theoretical misunderstandings. Modern chemistry is conventionally dated to Antoine Lavoisier (1743โ€“1794), often called the father of modern chemistry. Lavoisier demonstrated the law of conservation of mass in 1789, showing that matter is neither created nor destroyed in chemical reactions. He identified oxygen's role in combustion, dismantling the phlogiston theory, and co-authored the first systematic chemical nomenclature, establishing the language still used today. John Dalton proposed the first modern atomic theory in 1803, asserting that all matter is composed of indivisible atoms, that atoms of the same element are identical in mass, and that compounds form from fixed ratios of different atoms. This provided a physical basis for Lavoisier's conservation law and Proust's law of definite proportions. Dmitri Mendeleev published his periodic table in 1869, arranging the 63 known elements by atomic mass and revealing repeating patterns of chemical behavior. He boldly left gaps for undiscovered elements and predicted their properties with remarkable accuracy, predictions confirmed by the subsequent discovery of gallium, scandium, and germanium. Ernest Rutherford's gold foil experiment in 1911 revealed the nuclear model of the atom: a tiny, dense, positively charged nucleus surrounded by electrons. Niels Bohr refined this in 1913 with a quantized model of electron orbits that explained the hydrogen emission spectrum. Quantum chemistry and molecular orbital theory, developed through the 1920s and 1930s, provided the full quantum mechanical description of chemical bonding. The latter 20th century saw the rise of computational chemistry, enabling molecular simulation at unprecedented scale. The green chemistry movement, articulated in the 12 Principles of Green Chemistry in 1998, reoriented the field toward sustainability, waste reduction, and benign chemical design, reflecting chemistry's growing awareness of its environmental responsibilities.

Share this calculator

Explore More

Frequently Asked Questions

Protein molecular weight is calculated by summing the molecular weights of all individual amino acid residues in the sequence, then adding the molecular weight of one water molecule (18.015 Da). During peptide bond formation, one water molecule is lost per bond, but the N-terminus retains an extra hydrogen and the C-terminus retains an extra hydroxyl group, which together equal one water molecule. The average molecular weight of an amino acid residue is approximately 110 Da (after water loss), so a rough estimate is: MW = number of residues x 110. For precise calculations, each residue type has a specific weight ranging from 57 Da (Glycine) to 186 Da (Tryptophan).
The average molecular weight of a free amino acid is about 128 Da, but in a protein (after peptide bond formation and water loss), the average residue weight is approximately 110-111 Da. This average varies slightly depending on the amino acid composition. Glycine-rich proteins (e.g., collagen) have lower average residue weights (~85 Da for Gly residue), while tryptophan-rich proteins are heavier. The 110 Da average is commonly used for quick estimates: a 300-residue protein is approximately 33 kDa. For precision, always use the exact sequence-based calculation rather than the estimate.
You may use the results for reference and educational purposes. For professional reports, academic papers, or critical decisions, we recommend verifying outputs against peer-reviewed sources or consulting a qualified expert in the relevant field.
All calculations use established mathematical formulas and are performed with high-precision arithmetic. Results are accurate to the precision shown. For critical decisions in finance, medicine, or engineering, always verify results with a qualified professional.
No. All calculations run entirely in your browser using JavaScript. No data you enter is ever transmitted to any server or stored anywhere. Your inputs remain completely private.
The Formula section on this page shows the equation used. You can reproduce the calculation manually or in a spreadsheet using those steps. Compare your answer against the worked examples in the Examples section, which use known reference values so you can confirm the calculator is behaving as expected.
Educational Note: This calculator is provided for educational and informational purposes. Results are based on the formulas and inputs provided. Always verify important calculations independently. NovaCalculator processes calculator inputs client-side; optional analytics follow visitor consent settings. ยฉ 2024โ€“2026 NovaCalculator.

Share this calculator

Formula

MW = Sum of all residue weights + 18.015 Da (water)

Each amino acid residue contributes its specific molecular weight (ranging from 57 Da for glycine to 186 Da for tryptophan). One water molecule (18.015 Da) is added to account for the free N-terminal amino group and C-terminal carboxyl group. For estimates, use 110 Da per residue average. The extinction coefficient uses the Pace method: E280 = nTrp x 5500 + nTyr x 1490 + nCys x 125.

Frequently Asked Questions

How is protein molecular weight calculated from an amino acid sequence?

Protein molecular weight is calculated by summing the molecular weights of all individual amino acid residues in the sequence, then adding the molecular weight of one water molecule (18.015 Da). During peptide bond formation, one water molecule is lost per bond, but the N-terminus retains an extra hydrogen and the C-terminus retains an extra hydroxyl group, which together equal one water molecule. The average molecular weight of an amino acid residue is approximately 110 Da (after water loss), so a rough estimate is: MW = number of residues x 110. For precise calculations, each residue type has a specific weight ranging from 57 Da (Glycine) to 186 Da (Tryptophan).

What is the average molecular weight of an amino acid?

The average molecular weight of a free amino acid is about 128 Da, but in a protein (after peptide bond formation and water loss), the average residue weight is approximately 110-111 Da. This average varies slightly depending on the amino acid composition. Glycine-rich proteins (e.g., collagen) have lower average residue weights (~85 Da for Gly residue), while tryptophan-rich proteins are heavier. The 110 Da average is commonly used for quick estimates: a 300-residue protein is approximately 33 kDa. For precision, always use the exact sequence-based calculation rather than the estimate.

Can I use Protein Molecular Weight Calculator on a mobile device?

Yes. All calculators on NovaCalculator are fully responsive and work on smartphones, tablets, and desktops. The layout adapts automatically to your screen size.

What inputs do I need to use Protein Molecular Weight Calculator accurately?

Each field is labelled with the required unit (metric or imperial). Gather your source values before starting โ€” for example, a weight measurement in kilograms, a distance in metres, or a dollar amount โ€” and enter them exactly as measured. The formula section on this page lists every variable and explains what each represents.

How do I verify Protein Molecular Weight Calculator's result independently?

The Formula section on this page shows the equation used. You can reproduce the calculation manually or in a spreadsheet using those steps. Compare your answer against the worked examples in the Examples section, which use known reference values so you can confirm the calculator is behaving as expected.

Does Protein Molecular Weight Calculator work offline?

Once the page is loaded, the calculation logic runs entirely in your browser. If you have already opened the page, most calculators will continue to work even if your internet connection is lost, since no server requests are needed for computation.

References

Reviewed by Daniel Agrici, Founder & Lead Developer ยท Editorial policy