Protein Molecular Weight Calculator
Calculate protein molecular weight with our free science calculator. Uses standard scientific formulas with unit conversions and explanations.
Reviewed for accuracy by Daniel Agrici, Founder & Lead Developer
Protein Molecular Weight Calculator
Calculator
Adjust values & calculateEnter your values below. Every result is computed in your browser โ no data is sent to any server.
Formula: MW = Sum of all residue weights + 18.015 Da (water)
Worked example โ MW: ~3,401 Da (3.4 kDa) | E280: 4,470 M-1cm-1 | 30 residues
Formula
MW = Sum of all residue weights + 18.015 Da (water)
Each amino acid residue contributes its specific molecular weight (ranging from 57 Da for glycine to 186 Da for tryptophan). One water molecule (18.015 Da) is added to account for the free N-terminal amino group and C-terminal carboxyl group. For estimates, use 110 Da per residue average. The extinction coefficient uses the Pace method: E280 = nTrp x 5500 + nTyr x 1490 + nCys x 125.
Worked Examples
Example 1: Human Insulin B-Chain
Problem:Calculate the molecular weight of the insulin B-chain with sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (30 residues).
Solution:Sum individual residue weights: F(147.18) + V(99.13) + N(114.10) + Q(128.13) + H(137.14) + L(113.16) + C(103.14) + G(57.05) + S(87.08) + H(137.14) + L(113.16) + V(99.13) + E(129.12) + A(71.08) + L(113.16) + Y(163.18) + L(113.16) + V(99.13) + C(103.14) + G(57.05) + E(129.12) + R(156.19) + G(57.05) + F(147.18) + F(147.18) + Y(163.18) + T(101.11) + P(97.12) + K(128.17) + T(101.11) Sum + H2O (18.02) = 3,400.9 Da
Result:MW: ~3,401 Da (3.4 kDa) | E280: 4,470 M-1cm-1 | 30 residues
Example 2: Estimating MW from Residue Count
Problem:A protein has 450 amino acid residues. Estimate its molecular weight.
Solution:Using average residue weight of 110 Da: MW = 450 x 110 + 18 (water) = 49,518 Da Round: ~49.5 kDa This is typical of a medium-sized enzyme.
Result:Estimated MW: ~49.5 kDa | Typical range for 450 residues: 47-52 kDa
Frequently Asked Questions
How is protein molecular weight calculated from an amino acid sequence?
Protein molecular weight is calculated by summing the molecular weights of all individual amino acid residues in the sequence, then adding the molecular weight of one water molecule (18.015 Da). During peptide bond formation, one water molecule is lost per bond, but the N-terminus retains an extra hydrogen and the C-terminus retains an extra hydroxyl group, which together equal one water molecule. The average molecular weight of an amino acid residue is approximately 110 Da (after water loss), so a rough estimate is: MW = number of residues x 110. For precise calculations, each residue type has a specific weight ranging from 57 Da (Glycine) to 186 Da (Tryptophan).
What is the difference between Da and kDa?
Da (Dalton) is the standard unit for molecular weight, defined as 1/12 the mass of a carbon-12 atom, approximately 1.66 x 10^-24 grams. kDa (kilodalton) equals 1,000 Daltons and is commonly used for proteins because their molecular weights are typically in the thousands. A small protein like insulin is about 5.8 kDa, hemoglobin subunits are about 16 kDa, and a typical antibody (IgG) is about 150 kDa. In practice, most scientific literature reports protein MW in kDa. The term Dalton is equivalent to the older atomic mass unit (amu) and is named after John Dalton, the pioneer of atomic theory.
What is the extinction coefficient and why does it matter?
The molar extinction coefficient (E280) describes how strongly a protein absorbs ultraviolet light at 280nm wavelength. It is primarily determined by the number of tryptophan (W), tyrosine (Y), and cysteine (C) residues in the protein. The Pace method estimates: E280 = nTrp x 5500 + nTyr x 1490 + nCys x 125 M-1 cm-1. This value is essential for determining protein concentration using UV spectroscopy (Beer-Lambert law: A = E x c x l). Knowing the extinction coefficient allows you to measure absorbance at 280nm and directly calculate protein concentration, the most common method in biochemistry labs.
How accurate is Protein Molecular Weight Calculator for native proteins?
Protein Molecular Weight Calculator computes the theoretical molecular weight based on the primary amino acid sequence only. Actual molecular weight of native proteins can differ due to: post-translational modifications (glycosylation adds 2-30 kDa, phosphorylation adds ~80 Da per site), signal peptide cleavage (removes 15-30 residues), disulfide bond formation (loses 2 Da per bond), prosthetic group attachment, and protein complex formation. For SDS-PAGE, the apparent molecular weight can differ by 5-20% from the calculated value. For accurate native MW determination, use mass spectrometry, analytical ultracentrifugation, or size-exclusion chromatography.
What is the average molecular weight of an amino acid?
The average molecular weight of a free amino acid is about 128 Da, but in a protein (after peptide bond formation and water loss), the average residue weight is approximately 110-111 Da. This average varies slightly depending on the amino acid composition. Glycine-rich proteins (e.g., collagen) have lower average residue weights (~85 Da for Gly residue), while tryptophan-rich proteins are heavier. The 110 Da average is commonly used for quick estimates: a 300-residue protein is approximately 33 kDa. For precision, always use the exact sequence-based calculation rather than the estimate.
References
Background & Theory
History
Reviewed for accuracy by Daniel Agrici, Founder & Lead Developer ยท Editorial policy
Related Calculators
๐งฎCat BMI Calculator โ Is Your Cat a Healthy Weight?
Calculate cat bmicalculator with inputs, formulas, and instant results.
๐งฎHorse Weight Calculator
Calculate horse weight with inputs, formulas, and instant results.
๐งฎCat Benadryl Dosage Calculator (mg by Weight)
Calculate cat benadryl dosage with inputs, formulas, and instant results.
๐งฎDog Chocolate Toxicity Calculator
Calculate if the amount of chocolate your dog ate is dangerous based on dog weight and chocolate type.
๐งฎProtein Concentration Calculator
Calculate protein concentration with inputs, formulas, and instant results.
๐งฎDnato Protein Translator
Calculate dnato protein translator with inputs, formulas, and instant results.
๐งฎProtein Isoelectric Point Calculator
Calculate protein isoelectric point with inputs, formulas, and instant results.
๐งฎAlpaca Gestation Calculator
Calculate alpaca gestation with inputs, formulas, and instant results.