Amino Acid Frequency Calculator
Calculate amino acid frequency with our free science calculator. Uses standard scientific formulas with unit conversions and explanations.
Reviewed by Daniel Agrici, Founder & Lead Developer
Formula
Frequency(%) = (Count of amino acid / Total residues) x 100
Amino acid frequency is calculated by counting occurrences of each residue and dividing by total sequence length. Molecular weight is the sum of residue weights minus (N-1) water molecules for peptide bonds. Hydropathy uses the Kyte-Doolittle scale average.
Worked Examples
Example 1: Human Hemoglobin Alpha Chain Analysis
Problem:Analyze the amino acid frequency of the first 50 residues of human hemoglobin alpha chain: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH
Solution:Total residues: 50\nMost frequent: A (Alanine) = 7 (14.0%)\nNonpolar residues: ~56% (hydrophobic core)\nCharged residues: ~20%\nEstimated MW: ~5,500 Da\nGRAVY score: slightly negative (globular, soluble protein)
Result:50 residues | Top: Ala 14%, Leu 6%, Val 6% | MW: ~5,500 Da | Globular protein signature
Example 2: Collagen-like Sequence
Problem:Analyze a collagen-like repeat sequence: GPPGPPGPPGPPGPPGPPGPPGPPGPPGPP (Gly-Pro-Pro repeat, 30 residues).
Solution:Total residues: 30\nGlycine (G): 10 (33.3%)\nProline (P): 20 (66.7%)\nAll other amino acids: 0 (0%)\nNonpolar: 100%\nThis extreme composition is characteristic of collagen triple helix\nEstimated MW: ~2,700 Da
Result:30 residues | Gly 33.3%, Pro 66.7% | 100% nonpolar | Classic collagen signature
Frequently Asked Questions
What is amino acid frequency analysis and why is it useful?
Amino acid frequency analysis involves counting the occurrence of each of the 20 standard amino acids in a protein sequence and calculating their relative percentages. This analysis is fundamental in bioinformatics and molecular biology because it reveals important characteristics about protein structure and function. The amino acid composition can indicate whether a protein is membrane-bound (high hydrophobic residue content), an enzyme (specific catalytic residue patterns), or a structural protein (enriched in glycine and proline). Comparing amino acid frequencies between species reveals evolutionary relationships and codon usage biases. Unusual amino acid compositions can also flag potential errors in sequence data or identify proteins with specialized functions such as antifreeze proteins or silk proteins.
What are the different categories of amino acids?
The 20 standard amino acids are classified by the chemical properties of their side chains (R-groups). Nonpolar (hydrophobic) amino acids include alanine, valine, leucine, isoleucine, proline, phenylalanine, tryptophan, methionine, and glycine. These tend to be found in the protein interior, shielded from water. Polar (uncharged) amino acids include serine, threonine, asparagine, glutamine, tyrosine, and cysteine. They can form hydrogen bonds and are often found on protein surfaces. Positively charged (basic) amino acids include lysine, arginine, and histidine. Negatively charged (acidic) amino acids include aspartate and glutamate. The balance between these categories determines protein solubility, stability, folding patterns, and interaction with other molecules.
How is molecular weight estimated from amino acid sequence?
Molecular weight of a protein is estimated by summing the molecular weights of all individual amino acid residues and subtracting water molecules lost during peptide bond formation. Each peptide bond releases one water molecule (18.015 Da), so for a protein with N residues, you subtract (N-1) times 18.015 from the sum. Average amino acid residue molecular weights range from 75.03 Da for glycine to 204.23 Da for tryptophan. The average residue weight after water loss is approximately 110 Da, so a quick estimate is N times 110. This calculation gives a reasonable approximation but does not account for post-translational modifications such as glycosylation, phosphorylation, or disulfide bonds, which can significantly alter the actual molecular weight measured by mass spectrometry.
How does amino acid composition relate to protein evolution?
Amino acid composition patterns reveal evolutionary pressures acting on organisms and their proteins. Thermophilic organisms (those living at high temperatures) show enrichment in charged amino acids like glutamate, lysine, and arginine, which form stabilizing salt bridges. Halophilic organisms (salt-loving) show excess acidic residues on protein surfaces to maintain solubility in high salt. Genome-wide amino acid frequency biases reflect codon usage patterns shaped by mutational pressures and natural selection. GC-rich genomes tend to encode more alanine, glycine, proline, and arginine, while AT-rich genomes favor lysine, isoleucine, phenylalanine, and tyrosine. Comparing amino acid frequencies across orthologous proteins helps quantify evolutionary distance and identify conserved functional residues versus positions under relaxed selection.
References
Reviewed by Daniel Agrici, Founder & Lead Developer ยท Editorial policy